Outline
Comptes Rendus

Molecular biology and genetics/Biologie et génétique moléculaires
Isolation and functional characterization of DNA damage repair protein (DRT) from Lepidium latifolium L.
Comptes Rendus. Biologies, Volume 337 (2014) no. 5, pp. 302-310

Abstract

We have isolated and in silico characterized a cold regulated plastocyanin encoding gene from Lepidium latifolium L designated as LlaDRT. Its cDNA sequence (JN214346) consists of a 504 bp ORF, 48 and 205 bp of 5′ and 3′ UTR regions, respectively encoding a protein of 17.07 KDa and pI 4.95. In silico and phylogenetic analysis of LlaDRT suggested that the protein has features of a typical plastocyanin family member and of a nearest relative of the predominant isoform of Arabidopsis (PETE2) plastocyanin. Validation of stress response of LlaDRT by qPCR under different abiotic stress regulators viz salicylic acid, jasmonic acid, calcium chloride, ethylene and abscisic acid revealed its possible regulation and crosstalk amongst different pathways.

Supplementary Materials:
Supplementary material for this article is supplied as a separate file:

Metadata
Received:
Accepted:
Published online:
DOI: 10.1016/j.crvi.2014.03.006
Keywords: Cold stress proteins, Arabidopsis, Lepidium, Plastocyanin, Real-time polymerase chain reaction

Vimlendu Bhushan Sinha  1 , 2 , 3 ; Atul Grover  1 ; Zakwan Ahmed  1 ; Veena Pande  2

1 Defence Institute of Bio-Energy Research, Goraparao, PO Arjunpur, Haldwani 263139, India
2 Department of Biotechnology, Kumaun University, Bhimtal Campus, Uttarakhand 263136, India
3 University School of Biotechnology, Guru Gobind Singh Indraprastha University, Dwarka Sec. 16C, New Delhi 110078, India
Vimlendu Bhushan Sinha; Atul Grover; Zakwan Ahmed; Veena Pande. Isolation and functional characterization of DNA damage repair protein (DRT) from Lepidium latifolium L.. Comptes Rendus. Biologies, Volume 337 (2014) no. 5, pp. 302-310. doi: 10.1016/j.crvi.2014.03.006
@article{CRBIOL_2014__337_5_302_0,
     author = {Vimlendu Bhushan Sinha and Atul Grover and Zakwan Ahmed and Veena Pande},
     title = {Isolation and functional characterization of {DNA} damage repair protein {(DRT)} from {\protect\emph{Lepidium} latifolium} {L.}},
     journal = {Comptes Rendus. Biologies},
     pages = {302--310},
     year = {2014},
     publisher = {Elsevier},
     volume = {337},
     number = {5},
     doi = {10.1016/j.crvi.2014.03.006},
     language = {en},
}
TY  - JOUR
AU  - Vimlendu Bhushan Sinha
AU  - Atul Grover
AU  - Zakwan Ahmed
AU  - Veena Pande
TI  - Isolation and functional characterization of DNA damage repair protein (DRT) from Lepidium latifolium L.
JO  - Comptes Rendus. Biologies
PY  - 2014
SP  - 302
EP  - 310
VL  - 337
IS  - 5
PB  - Elsevier
DO  - 10.1016/j.crvi.2014.03.006
LA  - en
ID  - CRBIOL_2014__337_5_302_0
ER  - 
%0 Journal Article
%A Vimlendu Bhushan Sinha
%A Atul Grover
%A Zakwan Ahmed
%A Veena Pande
%T Isolation and functional characterization of DNA damage repair protein (DRT) from Lepidium latifolium L.
%J Comptes Rendus. Biologies
%D 2014
%P 302-310
%V 337
%N 5
%I Elsevier
%R 10.1016/j.crvi.2014.03.006
%G en
%F CRBIOL_2014__337_5_302_0

Original version of the full text

The full text below may contain a few conversion errors compared to the version of record of the published article.

1 Introduction

Studies involving abiotic stress tolerance in plants have identified that the expression of many genes vary in response to various abiotic stresses viz. temperature stress (both low and high), drought, salinity, oxidative stress, etc. [1], which resulted in reduced crop productivity [2,3]. Studies carried out for genome wide mRNA abundance have validated that the expression of around 5–30% of the genes are controlled by various abiotic stresses [4,5]. Plants have attained different strategies (mainly adaptive) at morphological, physiochemical, biochemical and cellular levels, which help them survive environmental extremes. Upregulated genes have always been given more importance, and extensive research on members of DREBs, MYB, bZIP proteins, and zinc finger families represents their importance in response to various environmental stresses. However, only a handful of literature [6] is available on genes, which are downregulated and research on all these genes are still lacking behind for elucidating their possible roles in the regulation of plants responses to stress.

Reports on genes encoding chlorophyll a/b-binding proteins, plastocyanin, and PSI subunit proteins have revealed their downregulation in response to cold stress [7–9]. It has been established that the plants acquire increased tolerance to photo-inhibition [10,11] particularly, owing to the shifting of photosynthetic carbon metabolism [12]. Plastocyanin, a type-I copper-containing a protein is found in cyanobacteria, algae, and plant chloroplasts. It is considered as one of the most abundant proteins in thylakoids [13,14] and plays a role in both linear and cyclic photosynthetic electron transport [15]. Plastocyanin, synthesized in the cytosol, acquires its mature form and Cu2+ co-factor [16] in the thylakoid lumen [17]. Light-stimulated responses are causative agents for the increase of plastocyanin mRNA levels and have been reported to play an important role in Arabidopsis, Hordeum, and Nicotiana [18,19]. Arabidopsis, Nicotiana, Oryza and other higher plants have been observed to possess/express two isoforms of plastocyanin [20–23]. PETE2 (DRT112) protein has been preferentially observed to be more abundant than PETE1 and their independent regulation for performing different roles in copper homeostasis as well as electron transport is known [24,25]. Studies on double mutant generated for Arabidopsis plastocyanin genes revealed their failure for growth due to an inhibition in light-driven electron transport [26]. Overexpression of the Spinacia plastocyanin promoter in Nicotiana has revealed a differential regulation of plastocyanin expression by oxidized and repressed plasto-quinone pool [27].

Lepdium latifolium L. ecotype Ladakh shows remarkable ability to withstand harsh environmental stress conditions [28] at different developmental stages, making it an excellent candidate for the exploration of genes related to abiotic stresses. Hence, Lepidium can serve as a source of genes and regulatory elements for abiotic stress tolerance through translational genomics approach and may also further aid in providing a deeper insight into the interaction of genes and networks, clarifying the interaction of genes and regulatory networks under adverse conditions [29]. Here, we describe the isolation, full-length cloning and expression pattern of DNA damage repair/toleration protein from Lepidium latifolium L. in response to various abiotic stresses.

2 Materials and methods

2.1 Plant material

Seeds of Llatifolium L. (Ladakh ecotype) were procured from Leh, India (11,500 ft asl). The collected seeds were germinated and seedlings were grown at 25 ± 2 °C, 150 μmol m−2 s−1 light intensity, 75% relative humidity and a 16:8 h photoperiod [30].

2.2 Rapid amplification of cDNA ends (RACE) and intron mapping

Total RNA was isolated from Llatifolium plants (three-week seedlings) by RNeasy mini kit (Qiagen, Germany) using the manufacturer's protocol from unstressed (control) and stressed leaves (4 °C for 24 h) of Llatifolium, quantified by spectrophotometry (Biorad, USA) and stored at –80 °C until further use. Based on EST sequence (FG618360), gene specific primers using Primer3 [31] were designed for RACE, which was carried out using GeneRacer™ kit (Invitrogen, USA) following the manufacturer's protocol. The amplified fragments were cloned in pGEM-T Easy vector (Promega, USA) and sequenced by M13 universal primers. The sequenced 5′ and 3′ RACE fragments were aligned together for removal of overlapping sequences and generation of full-length LlaDRT from Lepidium. Subsequently, extreme forward and reverse primers were designed from the ends of the full-length DRT gene sequence. All the primers designed for the study of LlaDRT are listed in Table 1.

Table 1

Description of the oligonucleotides used in this study.

S. No Name Sequence (5′–3′) Length (mer)
1 Primers for 3′ RACE
LlaDRT F1 CGAGGTTGCCTTGACTGAGC 20
LlaDRT F2 GCCACATCAGGGTGCTGGTA 19
GeneRacer™ 3′ outer GCTGTCAACGATACGCTACGT AACG 25
GeneRacer™ 3′ nested CGCTACGTAACGGCATGACAG TG 23
2 Primers for 5′ RACE
LlaDRT R1 GCCATACAACAATCACGGTCCA 22
LlaDRT R2 CCTCTAATTGAGGCCGAGAC 20
LlaDRT R3 TACCAGCACCCTGATGTGGC 20
GeneRacer™ 5′ outer CGACTGGAGCACGAG GACACT GA 23
GeneRacer™ 5′ nested GGACACTGACATGGA CTGAAG GAGTA 26
GeneRacer™ RNA oligo sequence CGACUGGAGCACGAGGACACUGACAUGGACUGAAGGAGUAGAAA 44
Oligo dT primer CGACUGGAGCACGAGGACACUGACAUGGACUGAAGGAGUAGAAA 60
3 Primers for full-length cloning and intron mapping
LlaDRT F ATGGCCTCAGTAACCTCAGCC 21
LlaDRT R TTAGTTAACGGTGAGTTTACCG 22
4 Primers for qPCR
26SrRNA F CACAATGATAGGAAGAGCCGAC 22
26SrRNA R CAAGGGAACGGGCTTGGCAGAAT 23
LlaDRT F1 CGAGGTTGCCTTGACTGAGC 20
LlaDRT R1 GCCATACAACAATCACGGTCCA 22

2.3 Multiple alignments and bioinformatics analysis

The full-length LlaDRT (JN214346) cDNA and the deduced amino acid sequence were compared against a non-redundant database of NCBI. Multiple alignments of the retrieved full-length amino acid sequences from the database were generated using ClustalW [32] and a bootstrapped phylogenetic tree [33] was obtained following the neighbour-joining method [34] using MEGA5 software [35]. The conserved motifs in sequences encoded by DRT cDNAs were detected by analysing protein sequences by MEME and BLOCKS software [36]. Conserved domains in DRT encoding sequences were analysed using the online utilities PROSITE (http://web.expasy.org/docs/swiss-prot_guideline.html) and SMART (http://smart.embl-heidelberg.de/).

2.4 Comparative quantification of transcript accumulation by qPCR

To investigate the expression patterns of LlaDRT in different concentrations of abiotic stress treatments (salicylic acid, absciscic acid, jasmonic acid, calcium chloride, and ethylene) at a given point of time, total RNA was isolated from Lepidium plants by RNeasy mini kit (Qiagen, Germany), following the manufacturer's instructions. The treatments of Lepidium seedlings (three weeks) were carried out following the procedure in [37]. cDNA was synthesized from purified (RNase free DNase treatment for genomic DNA contamination removal) RNA and quantified using a spectrophotometer. Equal quantities of synthesized cDNA were subjected to quantitative PCR (Mx3005P Stratagene/Agilent, USA) with SYBR green mastermix (Qiagen, Germany) and gene specific primers for LlaDRT in the reaction set-up. A housekeeping gene (26S rRNA) was used as the reference gene for the normalization/calibration reaction, which was amplified separately. The PCR conditions followed for the reaction set-up were initial denaturation at 95 °C for 10 min followed by 40 cycles of 95 °C for 30 s, 55 °C for 30 s and 72 °C for 30 s. The qPCR reactions were performed thrice to assess the reproducibility. Ct values obtained were analysed using statistical program Cropstat version 7.2 (IRRI, Philippines).

3 Results

3.1 Rapid amplification of cDNA ends (RACE)

The first round of 5′ RACE was carried out using the designed primers, which yielded an amplified product of 683 bp using Generacer™ 5′ outer primer and LlaDRT R1. Subsequent nested PCR with diluted template (1:50) of the above reaction with Generacer™ 5′ nested primer and LlaDRTR2 followed by Generacer™ 5′ nested primer and LlaDRTR3 resulted into the amplification of 597 bp and 526 bp, respectively (Fig. 1). In a similar fashion, 3′ RACE was carried out, first with Generacer™ 3′ outer primer and LlaDRT F1, followed by nested amplification using the primer set Generacer™ 3′ nested primer and LlaDRT F2 yielded amplified products of 296 bp and 251 bp, respectively (Fig. 2). The resulting clones obtained from RACE were cloned, sequenced and aligned to obtain full-length LlaDRT (JN214346) and reconfirmed by PCR amplification using LlaDRT F and LlaDRT R primers designed after the ORF prediction.

Fig. 1

The amplicons obtained after 5′ RACE in Lepidium latifolium L. (M – 1 Kb DNA ladder (Fermentas, Lithuania); L1 – product amplified (683 bp) using LlaDRT R1 and GeneRacer™ 5′ outer; L2 – product amplified (597 bp) using LlaDRT R2 and GeneRacer™ 3′ nested primer; L3 – product amplified (526 bp) using LlaDRT R2 and GeneRacer™ 3′ nested primer).

Fig. 2

The amplicons obtained after 3′ RACE in Lepidium latifolium L. (M – 1 Kb DNA ladder (Fermentas, Lithuania); L1 – product amplified (296 bp) using LlaDRT F1 GeneRacer™ 3′ outer; L2 – product amplified (251 bp) using LlaDRT F2 and GeneRacer™ 3′ nested primer).

3.2 Intron mapping of LlaDRT in Llatifolium L. Genome

cDNA and genomic DNA were amplified using LlaDRTF and LlaDRTR primers to find out the presence of introns, which revealed a similar product size of 504 bp (Fig. 3), which was confirmed by sequencing. This proves that LlaDRT from Llatifolium L. genome is devoid of introns.

Fig. 3

Full-length amplification of LlaDRT from Lepidium latifolium L. (M –1 Kb DNA ladder mix (Fermentas, Lithuania); L1 – product amplified (504 bp) using LlaDRT F LlaDRT R using genomic DNA as a template; L2 – product amplified (504 bp) using LlaDRT F and LlaDRT R using cDNA as a template).

3.3 Bioinformatics predictions for isolated LlaDRT

Retrieval of amino acids sequence using BLAST analyses and subsequent alignment by ClustalW revealed significant homology of LlaDRT with Arabidopsis (86%) and over 60% with most of the other similar protein sequences from dicots and monocots (Table 2). The bootstrapped phylogenetic tree constructed confirmed the closeness of LlaDRT with Arabidopsis, which was likely, since both are members of the Brassicacae family (Fig. 4). The multilevel consensus sequences in related sequences of LlaDRT were detected by MEME and BLOCKS (Table 3, Fig. 5), which indicates a 130-aa long conserved motif stretch with a match of P-value < 0.0001 and e-value < 10, suggesting a high conservation of the plastocyanin gene amongst plant species. Domain analysis elucidated a conserved copper-containing domain (TIGR02656) from 70–149 (cd length of 99) with an e-value of 5.48e–45. The members of this family contain blue copper protein associated/related closely with pseudoazurin, halocyanin, amicyanin, etc., located in the thylakoid lumen [26] and are considered as performing electron transport to photosystem I in cyanobacteria and chloroplasts. Another multidomain PETE (COG3794) was also detected from 73–167 (cd length of 128), having an e-value of 4.56e-16, which signifies the putative role that LlaDRT may play regarding energy production and conversion. The domain and other signatures sequences are probably retained by Llatifolium L. during the course of evolution, surpassing other selective constraints and thus, enabling plants to retain the properties associated with it. However, during the evolutionary processes, divergence from other similar sequences has also been observed by phylogenetic analysis, and it is possible that despite several similarities and conserved nature, it may have additional roles to play.

Table 2

Similarities in protein sequences of LlaDRT with reported sequences from other plants.

S. No Plant Gene name Accession no Length (aa) % Similarity with LlaDRT
1 Arabidopsis lyrata DNA damage repair/toleration protein 112 XP_002893099 167 86
2 Arabidopsis thaliana Plastocyanin major isoform AEE29963 167 86
3 Arabidopsis thaliana DRT112 AAA32787 167 83
4 Ricinus communis Plastocyanin A, chloroplast precursor XP_002510603 168 68
5 Pisum sativum Plastocyanin P16002 168 67
6 Silene latifolia Plastocyanin, chloroplastic P07030 165 67
7 Nicotiana benthamiana Chloroplast plastocyanin precursor ACV32157 169 69
8 Cucumis sativus Plastocyanin, chloroplastic like XP_004136366 166 70
9 Lotus japonicus Unknown AFK36672 167 67
10 Populus trichocarpa Predicted protein, plastocyanin XP_002307754 168 62
11 Medicago trunculata Plastocyanin XP_003603843 167 66
12 Solanum tuberosum Plastocyanin precursor AFW90573 170 66
13 Solanum commersonii Plastocyanin precursor CAJ19272 171 62
14 Plantago major Plastocyanin CAJ34813 160 61
15 Zea mays Plastocyanin NP_001147504 155 63
16 Hordeum vulgare Plastocyanin precursor CAA68696 155 53
17 Oryza sativa Plastocyanin precurssor AAB63590 154 57
Fig. 4

Phylogenetic relationship of LlaDRT in 15 different taxa deduced on the basis of protein sequence similarities.

Table 3

Multilevel consensus sequences for the MEME defined motifs among different DRT gene sequences. The motif match has a P-value < 0.0001 and the sequences used have an e-value < 10.

Motif Width Multilevel consensus sequence
1 130 PRLCIKASLKDFGVAVVATAASIMLASNAMAIEVLLGGDDGGLAFIPNDFSIAKGEKITFKNNAGFPHNVVFDEDEIPSGVDVSKISMDEQDLLNAPGETYEVTLTEKGTYSFYCAPHQGAGMVGKVTVN
2 21 MATVTSAAVAIPSFTGLKAGR
3 64 LLAGGAMAQDVLLGANDGVLVFEPNDFTVKAGETITFKNNAGFPHNVVFDEDECPSGVDWSKIS
4 29 QEEYLNAPGETYSVTLTVPGTYGFYCEPH
5 14 IKSSATVRIQTAAV
6 11 QGAGMVGKVTV
7 11 RRRRWVVRASL
8 14 KVSAIAKIPTSNSQ
9 8 CSSSRVST
10 6 PKWWIR
Fig. 5

(Colour online.) Motif identified using MEME and BLOCKS.

3.4 Quantitative expression analysis of LlaDRT in response to various abiotic stresses

Temporal gene expression studies of LlaDRT in response to various abiotic stresses were carried out by qPCR as described in the Materials and methods section. Documented studies on the induction of salicylic acid by abiotic stress in mutants and transgenic plants are available [38], and the expression level of the transcript when analysed by qPCR revealed the downregulation of LlaDRT by 0.67-fold and 0.73-fold when exposed to 10 μM and 50 μM salicylic acid stress, respectively compared to the control treatment (Fig. 6a), which may contribute to severe damage in abiotic stress. Considering that salicylic acid does not operate alone but moves in tandem with other phytohormones, like jasmonic acid and ethylene [39,40], we analysed the expression of LlaDRT under jasmonic acid and ethylene treatments. Jasmonic acid-related genes are reported to regulate defence mechanisms during pathogenesis and wounding [41]. Reports are available for jasmonic acid application for reduction of injury caused by cold stress in fruits [42]. Subsiding the salicylic acid operation with jasmonic acid, we also thought that plants might be responding to low temperature stress in a similar way to that they respond to pathogenic response/wounding stresses. qRT–PCR analysis of Lepidium seedlings submitted to 10 μM and 50 μM jasmonic acid foliar sprays showed significant transcript decreases (0.43-fold and 0.20-fold, respectively) compared to that of the control treatment set (Fig. 6b), reflecting its possible role in the freeze tolerance of plants, which may be further examined either by reverse genetics or metabolomics. Transcript accumulation was observed as 0.88-fold and 1.03-fold change by 10 μM and 50 μM ethylene foliar spray (Fig. 6c), respectively, suggesting that the ethylene responsive genes are not affecting LlaDRT and are independent of ethylene responsive pathways for its regulation. ABA is involved in the regulation of diverse plant processes and mediates expression of various stress responsive genes [43,44]. However, studies on Arabidopsis have shown that ABA responsive genes are induced by drought, but seem to be independent of ABA for the cold effect [45]. Seedlings exposed to ABA foliar sprays of 10 μM and 50 μM, when analysed with qPCR, showed significant downregulation of the LlaDRT transcript falling to 0.08-fold and 0.11-fold respectively, in comparison to the Mock/control treatment (Fig. 6d) qPCR carried out on Lepidium seedlings sprayed with 1 mM and 5 mM of calcium chloride, which showed a significant increase of the transcript with a 5 mM foliar spray. The fold change recorded for 1 mM and 5 mM sprays were 1.17 and 5.57 in comparison with the control (Fig. 6e), suggesting that the secondary messenger plays a role in LlaDRT regulation.

Fig. 6

Relative quantitative expression of LlaDRT in response to different abiotic stress regulators, viz. salicylic acid, jasmonic acid, ethylene, absciscic acid and calcium chloride. Lepidium latifolium seedlings exposed to (a) 10 μM and 50 μM of salicylic acid, (b) 10 μM and 50 μM of jasmonic acid, (c) 10 μM and 50 μM of ethylene, (d) 10 μM and 50 μM of absciscic acid, (e) 1 mM and 5 mM of calcium chloride. The treatment of stress regulators was given for 8 h and 26srRNA was used as an internal control. The error bars in each figure represent SE.

4 Discussion

DNA damage repair/toleration protein (DRT112), a copper ion binding/electron carrier, is one of the two reported Arabidopsis plastocyanin genes (PETE1 and PETE2), and is thought to be a predominant form, expressed around ten times stronger than PETE1. PETE2 (DRT) is expected to be post-transcriptionally regulated via copper homeostasis and thought to participate in the electron transfer between P700 and the cytochrome b6f complex in PSI. Physiological, biochemical and molecular changes [10,46] triggered by abiotic responses result from stable and long-term adaptations, explaining complex but necessary developmental responses [46]. Under the influence of low temperatures, inhibition of various metabolic processes, including photosynthetic carbon dioxide assimilation, occurs, which in turn creates imbalance and photo-oxidative damage [47]. Thus, energy imbalance is created; as a consequence of that, plants are forced to downregulate the photosynthetic genes for reduction in the absorbed light energy [48] and its recovery occurs by re-programming of the associated carbon metabolism [12,46]. This study highlights stress specific changes in the transcript level by application of different stress regulators. The increase in level of transcripts may be correlated with carbohydrate-mediated repression of photosynthesis when plants are shifted to a colder environment [48,49]. The fact that the same kind of results was not observed for all the studied abiotic stress treatments reflects that these stresses have different impacts on photosynthesis, both in shorter and longer durations. This indicates that if the studied gene is used for the generation of transgenic or breeding programs, it may provide some interesting regulations that had not yet been unfolded so far. This study also makes a major point in potential values of studying plastocyanin-related genes; the results obtained in the frame of our study may provide useful points for investigating the molecular mechanism of photosynthetic genes regulation during abiotic stress.

Disclosure of interest

The authors declare that they have no conflicts of interest concerning this article.

Acknowledgement

Vimlendu Bhushan Sinha is thankful to the Defence Research Development Organization (DRDO), India, for financial support. The authors also thank the Defence Institute of High altitude Research (DIHAR), Leh, India for their cooperation in collection of the plant material.


References

[1] K. Nakashima; Y. Ito; K. Yamaguchi-Shinozaki Transcriptional regulatory networks in response to abiotic stresses in Arabidopsis and grasses, Plant Physiol., Volume 149 (2009), pp. 88-95

[2] H. Koca; M. Bor; F. Özdemir; İ. Türkan The effect of salt stress on lipid peroxidation, antioxidative enzymes and proline content of sesame cultivars, Environ. Exp. Bot., Volume 60 (2007), pp. 344-351

[3] K. Suzuki; K. Nagasuga; M. Okada The chilling injury induced by high root temperature in the leaves of rice seedlings, Plant Cell Physiol., Volume 49 (2008), pp. 433-442

[4] M.A. Rabbani Monitoring expression profiles of rice genes under cold, drought, and high-salinity stresses and abscisic acid application using cDNA microarray and RNA Gel-blot analyses, Plant Physiol., Volume 133 (2003), pp. 1755-1767

[5] R. Wang Genomic analysis of the nitrate response using a nitrate reductase-null mutant of Arabidopsis, Plant Physiol., Volume 136 (2004), pp. 2512-2522

[6] V.B. Sinha Studies on freezing stress downregulated genes from Lepidium, Department of Biotechnology, Kumaun University, Nainital, India, 2011

[7] S. Fowler; M.F. Thomashow Arabidopsis transcriptome profiling indicates that multiple regulatory pathways are activated during cold acclimation in addition to the cbf cold response pathway, Plant Cell, Volume 14 (2002), pp. 1675-1690

[8] M. Seki; M. Narusaka; J. Ishida; T. Nanjo; M. Fujita; Y. Oono; A. Kamiya; M. Nakajima; A. Enju; T. Sakurai Monitoring the expression profiles of 7000 Arabidopsis genes under drought, cold and high-salinity stresses using a full-length cDNA microarray, Plant J., Volume 31 (2002), pp. 279-292

[9] J. Zhou; X. Wang; Y. Jiao; Y. Qin; X. Liu; K. He; C. Chen; L. Ma; J. Wang; L. Xiong Global genome expression analysis of rice in response to drought and high-salinity stresses in shoot, flag leaf, and panicle, Plant Mol. Biol., Volume 63 (2007), pp. 591-608

[10] N.A. Huner; G. Öquist; V. Hurry; M. Krol; S. Falk; M. Griffith Photosynthesis, photo-inhibition and low temperature acclimation in cold tolerant plants, Photosynth Res., Volume 37 (1993), pp. 19-39

[11] G.R. Gray; B.J. Hope; X. Qin; B.G. Taylor; C.L. Whitehead The characterization of photoinhibition and recovery during cold acclimation in Arabidopsis thaliana using chlorophyll fluorescence imaging, Physiol. Plant, Volume 119 (2003), pp. 365-375

[12] G.R. Gray; D. Heath A global reorganization of the metabolome in Arabidopsis during cold acclimation is revealed by metabolic fingerprinting, Physiol. Plant, Volume 124 (2005), pp. 236-248

[13] T. Kieselbach; Å. Hagman; B. Andersson; W.P. Schröder The thylakoid lumen of chloroplasts. Isolation and characterization, J. Biol. Chem, Volume 273 (1998), pp. 6710-6716

[14] M. Schubert; U.A. Petersson; B.J. Haas; C. Funk; W.P.S. der; T. Kieselbach Proteome map of the chloroplast lumen of Arabidopsis thaliana, J. Biol. Chem., Volume 277 (2001), pp. 8354-8365

[15] P. Joliot; A. Joliot Cyclic electron flow in C3 plants, Biochim. Biophys. Acta–Bioenergetics, Volume 1757 (2006), pp. 362-368

[16] H.M. Li; T. Moore; K. Keegstra Targeting of proteins to the outer envelope membrane uses a different pathway than transport into chloroplasts, Plant Cell, Volume 3 (1991), pp. 709-717

[17] S.S. Merchant; M.D. Allen; J. Kropat; J.L. Moseley; J.C. Long; S. Tottey; A.M. Terauchi Between a rock and a hard place: trace element nutrition in Chlamydomonas, Biochim. Biophys. Acta–Mol. Cell Res., Volume 1763 (2006), pp. 578-594

[18] D. Last; J. Gray Synthesis and accumulation of pea plastocyanin in transgenic tobacco plants, Plant Mol. Biol., Volume 14 (1990), pp. 229-238

[19] O. Vorst; P. Kock; A. Lever; B. Weterings; P. Weisbeek; S. Smeekens The promoter of the Arabidopsis thaliana plastocyanin gene contains a far upstream enhancer-like element involved in chloroplast-dependent expression, Plant J., Volume 4 (1993), pp. 933-945

[20] M.I. Dimitrov; A.A. Donchev; T.A. Egorov Twin plastocyanin dimorphism in tobacco, Biochim. Biophys. Acta–Protein Struct. Mol. Enzymol., Volume 1203 (1993), pp. 184-190

[21] T. Kieselbach; M. Bystedt; P. Hynds; C. Robinson; W.P. Schröder A peroxidase homologue and novel plastocyanin located by proteomics to the Arabidopsis chloroplast thylakoid lumen, FEBS Lett., Volume 480 (2000), pp. 271-276

[22] A. Shosheva; A. Donchev; M. Dimitrov; G. Kostov; G. Toromanov; V. Getov; E. Alexov Comparative study of the stability of poplar plastocyanin isoforms, Biochim. Biophys. Acta–Proteins and Proteomics, Volume 1748 (2005), pp. 116-127

[23] S.A. Rensing; D. Lang; A.D. Zimmer; A. Terry; A. Salamov; H. Shapiro; T. Nishiyama; P.-F. Perroud; E.A. Lindquist; Y. Kamisugi The Physcomitrella genome reveals evolutionary insights into the conquest of land by plants, Science, Volume 319 (2008), pp. 64-69

[24] S.E. Abdel-Ghany; M. Pilon MicroRNA-mediated Systemic downregulation of copper protein expression in response to low copper availability in Arabidopsis, J. Biol. Chem., Volume 283 (2008), pp. 15932-15945

[25] S. Abdel-Ghany; Esmat Contribution of plastocyanin isoforms to photosynthesis and copper homeostasis in Arabidopsis thaliana grown at different copper regimes, Planta, Volume 229 (2008), pp. 767-779

[26] M. Weigel; C. Varotto; P. Pesaresi; G. Finazzi; F. Rappaport; F. Salamini; D. Leister Plastocyanin is indispensable for photosynthetic electron flow in Arabidopsis thaliana, J. Biol. Chem., Volume 278 (2003), pp. 31286-31289

[27] T. Pfannschmidt; K.S. tze; M. Brost; R.O. ller A Novel mechanism of nuclear photosynthesis gene regulation by redox signals from the chloroplast during photosystem stoichiometry adjustment, J. Biol. Chem., Volume 276 (2001), pp. 36125-36130

[28] S.M. Gupta; A. Grover; Z. Ahmed Identification of abiotic stress responsive genes from Indian high altitude Lepidium latifolium L, Defence Sci. J., Volume 62 (2012), pp. 315-318

[29] A.H. Paterson; J.E. Bowers; R. Bruggmann; I. Dubchak; J. Grimwood; H. Gundlach; G. Haberer; U. Hellsten; T. Mitros; A. Poliakov; J. Schmutz; M. Spannagl; H. Tang; X. Wang; T. Wicker; A.K. Bharti; J. Chapman; F.A. Feltus; U. Gowik; I.V. Grigoriev; E. Lyons; C.A. Maher; M. Martis; A. Narechania; R.P. Otillar; B.W. Penning; A.A. Salamov; Y. Wang; L. Zhang; N.C. Carpita; M. Freeling; A.R. Gingle; C.T. Hash; B. Keller; P. Klein; S. Kresovich; M.C. McCann; R. Ming; D.G. Peterson; R. Mehboob ur; D. Ware; P. Westhoff; K.F.X. Mayer; J. Messing; D.S. Rokhsar The Sorghum bicolor genome and the diversification of grasses, Nature, Volume 457 (2009), pp. 551-556

[30] M. Aslam; V.B. Sinha; R.K. Singh; S. Anandhan; V. Pande; Z. Ahmed Isolation of cold stress-responsive genes from Lepidium latifolium by suppressive subtraction hybridization, Acta Physiol. Plant., Volume 32 (2010), pp. 205-210

[31] A. Untergasser; H. Nijveen; X. Rao; T. Bisseling; R. Geurts; J.A. Leunissen Primer3Plus, an enhanced web interface to Primer3, Nucleic Acids Res., Volume 35 (2007), p. W71-W74

[32] J.D. Thompson; D.G. Higgins; T.J. Gibson CLUSTAL W: improving the sensitivity of progressive multiple sequence alignment through sequence weighting, position-specific gap penalties and weight matrix choice, Nucleic Acids Res., Volume 22 (1994), pp. 4673-4680

[33] J. Felsenstein Confidence limit on phylogenies: an approach using bootstrap, Evolution, Volume 39 (1985), pp. 783-791

[34] N. Saitou; M. Nei The neighbor-joining method: a new method for reconstructing phylogenetic trees, Mol. Biol. Evol., Volume 4 (1987), pp. 406-425

[35] K. Tamura; D. Peterson; N. Peterson; G. Stecher; M. Nei; S. Kumar MEGA5: molecular evolutionary genetics analysis using maximum likelihood, evolutionary distance, and maximum parsimony methods, Mol. Biol. Evol., Volume 28 (2011), pp. 2731-2739

[36] T.L. Bailey; N. Williams; C. Misleh; W.W. Li MEME: discovering and analyzing DNA and protein sequence motifs, Nucleic Acids Res., Volume 34 (2006), p. W369-W373

[37] M. Aslam; A. Grover; V.B. Sinha; B. Fakher; V. Pande; P.V. Yadav; S.M. Gupta; S. Anandhan; Z. Ahmed Isolation and characterization of cold responsive NAC gene from Lepidium latifolium, Mol. Biol. Rep., Volume 39 (2012), pp. 9629-9638

[38] A.C. Vlot; D.M.A. Dempsey; D.F. Klessig Salicylic acid, a multifaceted hormone to combat disease, Ann. Rev. Phytopathol., Volume 47 (2009), pp. 177-206

[39] A. Koornneef; C.M.J. Pieterse Cross talk in defense signaling, Plant Physiol., Volume 146 (2008), pp. 839-844

[40] S.H. Spoel; X. Dong Making sense of hormone crosstalk during plant immune responses, Cell Host Microbe, Volume 3 (2008), pp. 348-351

[41] C. Wasternack; B. Hause Jasmonates and octadecanoids: signals in plant stress responses and development, Prog. Nucleic Acid Res. Mol. Biol., Volume 72 (2002), pp. 165-221

[42] G.A. González-Aguilar; J. Fortiz; R. Cruz; R. Baez; C.Y. Wang Methyl jasmonate reduces chilling injury and maintains post-harvest quality of mango fruit, J. Agr. Food Chem., Volume 48 (2000), pp. 515-519

[43] J.-K. Zhu Salt and drought stress signal transduction in plants, Ann. Rev. Plant Biol., Volume 53 (2002), pp. 247-273

[44] K. Shinozaki; K. Yamaguchi-Shinozaki; M. Seki Regulatory network of gene expression in the drought and cold stress responses, Curr. Opin. Plant Biol., Volume 6 (2003), pp. 410-417

[45] C.L.d. Bruxelles; W.J. Peacock; E.S.R. Dennis Dolferus, abscisic acid lnduces the alcohol dehydrogenase gene in Arabidopsis, Plant Physiol., Volume 111 (1996), pp. 381-391

[46] M. Stitt; V. Hurry A plant for all seasons: alterations in photosynthetic carbon metabolism during cold acclimation in Arabidopsis, Curr. Opin. Plant Biol., Volume 5 (2002), pp. 199-206

[47] N.P.A. Huner; G. Öquist; F. Sarhan Energy balance and acclimation to light and cold, Trends Plant Sci., Volume 3 (1998), pp. 224-230

[48] Å. Strand; V. Hurry; P. Gustafsson; P. Gardeström Development of Arabidopsis thaliana leaves at low temperatures releases the suppression of photosynthesis and photosynthetic gene expression despite the accumulation of soluble carbohydrates, Plant J., Volume 12 (1997), pp. 605-614

[49] Å. Strand; C. Foyer; P. Gustafsson; P. Gardeström; V. Hurry Altering flux through the sucrose biosynthesis pathway in transgenic Arabidopsis thaliana modifies photosynthetic acclimation at low temperatures and the development of freezing tolerance, Plant Cell Environ., Volume 26 (2003), pp. 523-535


Comments - Policy